100μL

Product Name: Arl3 Protein Q71L mutant

Synonyms: ADP-ribosylation factor-like 3, ARFL3

Catalogue Number:  10166

Source:  Human, recombinant full length, His₆-tag

Expression Host: E. coli

Molecular Weight: 20 kDa

Purity: >95% by SDS-PAGE

Introduction: Arl3 belongs to the member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases. Arl3 is also a member of the ADP-ribosylation factor family of GTP-binding proteins. Arl3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.

Amino Acid Sequence (1-182, Q71L)

MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGLRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK

Properties

Physical Appearance (form):  Lyophilized Powder from 20 mM Tris-HCl, pH 7.4, containing 100 mM NaCl.

Physical Appearance (color): White

Solubility (Color): colorless

Solubility (Turbidity): clear, 10 mg/mL H₂O

Storage:  -80°C

Preparation Instructions

Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM b-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl b-D-maltoside (DoDM) or polyethylene detergents (e.g. C₁₂E₁₀) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution.

References

1.         Cavenagh, M. M. et al., J. Biol. Chem. 269: 18937-18942, 1994.

2.         Grayson, C. et al., Hum. Molec. Genet. 11: 3065-3074, 2002.

3.         Kim, H.-S. Cytogenet. Cell Genet. 83: 246-only, 1998.

4.         Schrick, J. JAm. J. Path. 168: 1288-1298, 2006.

Veltel, S. et al., Nature Struct. Molec. Biol. 15: 373-380, 2008.