100μL

Product Name: CST3 Protein

Synonyms: Cystatin C, Cystatin 3, CYSC

Catalogue Number:  10157

Source: Human, recombinant full length, His₆-tag

Expression Host: E. coli

Molecular Weight: 16 kDa

Purity: >95% by SDS-PAGE

Introduction: Cystatin C, which belongs to the type 2 cystatin gene family, is a potent inhibitor of lysosomal proteinases. It regulates the activity of cathepsin S, a protease with central regulatory functions in retinal pigment epithelial (RPE) cells.

Amino Acid Sequence (1-146)

MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Properties

Physical Appearance (form):  Lyophilized Powder from 20 mM Tris-HCl, pH 7.4, containing 100 mM NaCl.

Physical Appearance (color): White

Solubility (Color): colorless

Solubility (Turbidity): clear, 10 mg/mL H₂O

Storage:  -80°C

Preparation Instructions

Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM b-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl b-D-maltoside (DoDM) or polyethylene detergents (e.g. C₁₂E₁₀) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution.

References

1.         Paraoan, L. et al., Traffic 5: 884-895, 2004.

2.         Ratnayaka, A. et al., Exp. Eye Res. 84: 1135-1139, 2007.

Zurdel, J. et al., Brit. J. Ophthal. 86: 214-219, 2002.