100μL

Product Name: Cdc42 Protein
Synonyms: Cell division cycle 42, G25K, CDC42Hs
Catalogue Number:  10108
Source: Human, recombinant full length, GST-tag
Expression Host: E. coli
Molecular Weight:  21 kDa
Purity: >95% by SDS-PAGE

Introduction: Small GTPases are a super-family of cellular signaling regulators. Cdc42 belongs to the Rho sub-family of GTPases that regulate cell motility, cell division, and gene transcription. GTP binding increases the activity of Cdc42, and the hydrolysis of GTP to GDP renders it inactive. GTP hydrolysis is aided by GTPase activating proteins (GAPs), while exchange of GDP for GTP is facilitated by guanine nucleotide exchange factors (GEFs).

Amino Acid Sequence (1-191)
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

Properties
Physical Appearance (form):  Lyophilized Powder from 20 mM Tris-HCl, pH 7.4, containing 100 mM NaCl.
Physical Appearance (color): White
Solubility (Color): colorless

Solubility (Turbidity): clear, 10 mg/mL H2O
Storage:  -80°C

Preparation Instructions
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM -mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl -D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution.

References
1. Garrett, W. S. . et al., Cell 102: 325-334, 2000.
2. Irie, F. et al., Nature Neurosci. 5: 1117-1118, 2002.
3. Kawasaki, Y. et al., Oncogene 26: 7620-7627, 2007.
4. Manser, E. et al., Nature 363: 364-367, 1993.
5. Musch, A. et al., EMBO J. 20: 2171-2179, 2001.
6. Nalbant, P. et al., Science 305: 1615-1619, 2004.
7. Shen, Y. et al., Dev. Cell 14: 342-353, 2008.
8. Wu, W. J. et al., Nature 405: 800-804, 2000.
9. Wu, X. et al., Genes Dev. 20: 571-585, 2006.
10. Zheng, Y. et al., J. Biol. Chem. 271: 33169-33172, 1996.